Glixx Laboratories Inc
Your exclusive source for bioactive molecules
Glixx Laboratorie
CAS: 122384-88-7
Chemical Name: Human islet amyloid polypeptide; Amylin; Diabetes Associated Peptide Amide human; KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bridge 2-7; H-Lys-Cys(1)-Asn-Thr-Ala-Thr-Cys(1)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Purity: >98% (HPLC)
Human islet amyloid polypeptide, being associated with development of type-II diabetes mellitus (T2DM)
Place an order!
POA | |||
Bulk inquiry contact: | |||
sales@glixxlabs.com |
|||
service@glixxlabs.com |